PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008237971.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 219aa    MW: 25270.3 Da    PI: 5.1414
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008237971.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.5e-21101161257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     r+R+t+t+ ql+ Le+ Fe+ + +p +++++e++++l    +++e++V++WFqNrRa+ k+
  XP_008237971.1 101 RQRWTPTPVQLQMLERIFEEgTGTPCKQKIKEITMELtqhgQISETNVYNWFQNRRARSKR 161
                     89*****************99**************************************97 PP

2Wus_type_Homeobox100.99.1e-33100163265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q+++Le+++++G+ tP k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
     XP_008237971.1 100 ARQRWTPTPVQLQMLERIFEEGTGTPCKQKIKEITMELTQHGQISETNVYNWFQNRRARSKRKQ 163
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-1795165IPR009057Homeodomain-like
PROSITE profilePS5007114.31797162IPR001356Homeobox domain
SMARTSM003899.9E-1399166IPR001356Homeobox domain
SuperFamilySSF466892.65E-17100164IPR009057Homeodomain-like
CDDcd000863.33E-13101163No hitNo description
PfamPF000461.1E-18101161IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MMEWQQQQQQ QQIQNQQQII HHLQNPEDGI GNGNGGLYVK VMTDEQMELL RRQIAVYATI  60
CEQLVEMHKA VTAQQDLSGM RLGNFYCDPF MASGGHKITA RQRWTPTPVQ LQMLERIFEE  120
GTGTPCKQKI KEITMELTQH GQISETNVYN WFQNRRARSK RKQSVPAQNN GESEAEPEVE  180
SPRDEKTKPE DIMSLDNSAP RAENMYLQSP ELGFGNFDW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154162RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008237971.11e-165PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM37e-79WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLM5WVH21e-150M5WVH2_PRUPE; Uncharacterized protein
STRINGVIT_18s0122g01140.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.15e-75WUSCHEL related homeobox 13